AOD9604 is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Updated 2026-03-18. Numbers and descriptions here follow the published literature rather than marketing material.
AOD-9604 is a synthetic peptide modeled on the C-terminal region of human growth hormone. It corresponds to residues 176-191 of the 191-amino-acid hGH sequence. The fragment is not the full hormone and lacks the receptor-binding region associated with growth and metabolic effects of hGH. Researchers developed it to isolate a specific portion of hGH for study. Its exact sequence and length are often stated in peptide catalogs and patents.
The peptide is frequently described as a growth hormone fragment, although it is chemically distinct from full-length hGH. AOD-9604 contains 16 amino acids and includes two cysteine residues that can form an intramolecular disulfide bond. In solution, this structural feature can influence folding, aggregation, and stability. Published descriptions sometimes call it hGH 176-191 or AOD9604, with spacing and capitalization varying. Such naming differences can complicate literature searches, database entries, and product verification.
Researchers have studied the fragment in cell and animal models to understand its metabolic actions. Some experiments report effects on fat breakdown and fat storage pathways, but the underlying mechanism remains incompletely defined. AOD-9604 does not appear to stimulate the same broad growth hormone receptor signaling as full-length hGH. Whether its observed activities arise from direct receptor interactions or downstream metabolic changes is an open question. Results from different assays are not always consistent.
Regulatory treatment of AOD-9604 has varied. In sports anti-doping, the peptide became widely discussed during a 2013 investigation into an Australian professional sports club. Authorities at the time debated whether it fell under prohibitions on growth hormone and related substances. Later clarifications and updated lists have addressed the compound in different ways. Anyone seeking current status should consult the latest applicable rules, and commercial supply for human use is not authorized in major markets.
Research interest in AOD-9604 often focuses on whether it can influence lipid metabolism without the growth-promoting or glucose-related effects of full-length hGH. This question remains unresolved, and findings depend on model, dose, and measurement method. Some reviews treat the peptide as a historical obesity candidate rather than an active therapeutic. Others cite it in discussions of peptide fragments, metabolic signaling, and performance-enhancing substances. Clear conclusions are limited by the small number of rigorous, independent human studies.
| Property | Value | Notes |
|---|---|---|
| Molecular class | Synthetic peptide | Derived from a fragment of human growth hormone |
| Sequence basis | hGH residues 176-191 | Commonly described as a 16-amino-acid fragment |
| Appearance | White to off-white powder | Typical for lyophilized research peptides |
| Solubility | Soluble in water or aqueous buffer | Exact solubility depends on pH and purity |
| Common synonyms | AOD9604; hGH 176-191 | Spelling and punctuation vary across sources |
AOD-9604 is a synthetic peptide modeled on the C-terminal region of human growth hormone. It is often described as hGH fragment 176-191. Research interest arose because it was designed to isolate possible effects on fat metabolism from other actions of growth hormone. It is not a full growth hormone molecule. Its development history includes early laboratory and animal studies followed by human trials. The peptide has been examined in laboratory, animal, and limited human studies.
The compound has been studied as a potential treatment for obesity and related metabolic conditions. Published trials have examined changes in body weight, fat mass, and safety markers over limited durations. Results have been mixed or modest, and no large-scale outcome trials are established. Regulatory agencies in several countries have not approved it as a therapeutic drug. Some commercial products have been marketed outside regulated pharmaceutical channels, which raises questions about quality and claims.
In the scientific literature, AOD-9604 appears in reviews of growth hormone fragments and in discussions of peptide-based metabolic research. Some sources distinguish it from growth hormone itself, while others group it with compounds marketed for weight management. The evidence base is small compared with approved obesity medications. Questions about long-term efficacy and clinical relevance remain open, and independent replication of key findings is limited. Most published reports are early-stage and exploratory.
Research has examined whether the peptide affects fat mass independently of growth hormone's other actions. Early animal studies suggested reductions in body fat, but species differences and small sample sizes limit interpretation. Human studies have generally been short and have not consistently shown large effects. Some trials measured body composition, lipid profiles, and safety parameters, but the overall picture is one of suggestive yet inconclusive metabolic activity. Findings vary across study populations and protocols.
A central uncertainty is whether observed metabolic changes translate into meaningful clinical benefits. Study designs vary in dose, duration, and participant characteristics, making comparisons difficult. Independent replication is limited, and the field lacks consensus on optimal endpoints or treatment duration. Ongoing or future studies may clarify mechanism and effect size, but current evidence does not establish a clear therapeutic role. Researchers often call for larger, longer, and better-controlled trials, while questions remain about which patient groups might respond.
Proposed mechanism focuses on lipolysis, the breakdown of stored triglycerides into free fatty acids and glycerol. AOD-9604 is thought to act on adipose tissue without stimulating appetite or affecting blood sugar in the same way as growth hormone. Laboratory studies report increased fat oxidation in some models. The precise receptor interactions and signaling pathways remain incompletely characterized. Researchers have proposed that the peptide may influence fat mobilization through pathways distinct from the full hormone.
AOD9604 is a synthetic peptide modeled on the C-terminal region of human growth hormone. It corresponds to a short sequence near the end of the 191-amino-acid hormone, often described as residues 176–191 or a related fragment. Researchers designed it to separate metabolic effects from the growth-promoting actions of full-length growth hormone. Early work in the 1990s explored it as a candidate for weight and lipid disorders. It is not a naturally circulating hormone fragment produced in large amounts.
Laboratory studies have reported that AOD9604 can increase lipolysis and reduce lipid accumulation in fat cells. The precise molecular target remains uncertain, and the compound does not appear to activate the growth hormone receptor in the same way as full-length hGH. Proposed mechanisms include effects on beta-adrenergic signaling and enzymes involved in fatty acid synthesis, but these pathways are not firmly established. Because most evidence comes from cell and animal models, whether the same effects occur in humans is an open question.
Clinical development of AOD9604 included trials in people with obesity, but the results did not lead to approval as a prescription medicine in major markets. Interest later shifted to research settings and to unapproved products marketed for body composition. Regulatory agencies have questioned whether the peptide qualifies as a dietary ingredient, and some have issued warnings about its presence in supplements. Long-term human safety data are limited, and questions about efficacy, dosing, and target populations remain unresolved.
== Ecology == The Rotheca myricoides interacts with several other species. Pseumenes depressus, the Asian hornet, and Xylocopa ruficeps all visit the Rotheca myricoides. Xylocopa phalothorax, Xylocopa tranquebarorum, and Xylocopa nasalis eat the Rotheca myricoides. The plant plays a significant role in its native ecosystems by supporting pollinators like butterflie and bees. Its long corolla tubes are adapted to attract specific pollinators with long proboscises for effective pollen transfer. The plant provides food to birds that consume its drupes, helping in seed dispersal. The status on the Red List of South African plants is at "Least Concern" as assessed on 2005/06/30, as it was not highlighted as a potential taxa for conservation concern.
. The four approaches deliver slightly different information. Although the results of clamp-, IVGTT-, OGTT- and SPINA-derived disposition indices significantly correlate with each other the correlations are only modest. In direct comparison, the SPINA-based disposition index (SPINA-DI) had higher discriminatory power for the diagnosis of diabetes than the OGTT-based disposition index according to Matsuda and DeFronzo.
In humans, EGF has 53 amino acids (sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCzYRDLKWWELR), with a molecular mass of around 6 kDa. It contains three disulfide bridges (Cys6-Cys20, Cys14-Cys31, Cys33-Cys42).
=== Sports === Professional athletes have been documented using sildenafil, believing the opening of their blood vessels will enrich their muscles. In turn, they believe it will enhance their performances.
Sources: en.wikipedia.org
=== Graphite oxide reduction === P. Boehm reported producing monolayer flakes of reduced graphene oxide in 1962. Rapid heating of graphite oxide and exfoliation yields highly dispersed carbon powder with a few percent of graphene flakes. Another method is the reduction of graphite oxide monolayer films, e.g. by hydrazine with annealing in argon/hydrogen with an almost intact carbon framework that allows efficient removal of functional groups. Measured charge carrier mobility exceeded 1,000 cm/Vs (10 m/Vs). Burning a graphite oxide coated DVD produced a conductive graphene film (1,738 siemens per meter) and specific surface area (1,520 square meters per gram) that was highly resistant and malleable. A dispersed reduced graphene oxide suspension was synthesized in water by a hydrothermal dehydration method without using any surfactant. The approach is facile, industrially applicable, environmentally friendly, and cost-effective. Viscosity measurements confirmed that the graphene colloidal suspension (graphene nanofluid) exhibits Newtonian behavior, with the viscosity showing a close resemblance to that of water.
Arginine is the amino acid with the formula (H2N)(HN)CN(H)(CH2)3CH(NH2)CO2H. The molecule features a guanidino group appended to a standard amino acid framework. At physiological pH, the carboxylic acid is deprotonated (−CO2−) and both the amino and guanidino groups are protonated, resulting in a cation. Only the L-arginine (symbol Arg or R) enantiomer is found naturally. Arg residues are common components of proteins. It is encoded by the codons CGU, CGC, CGA, CGG, AGA, and AGG. The guanidine group in arginine is the precursor for the biosynthesis of nitric oxide. Like all amino acids, it is a white, water-soluble solid. The one-letter symbol R was assigned to arginine for its phonetic similarity in English.
Saccharomyces cerevisiae alcohol dehydrogenase 4 (gene ADH4) Zymomonas mobilis alcohol dehydrogenase 2 (gene adhB) Escherichia coli propanediol oxidoreductase EC 1.1.1.77 (gene fucO), an enzyme involved in the metabolism of fucose and which also seems to contain ferrous ion(s). Clostridium acetobutylicum NADPH- and NADH-dependent butanol dehydrogenases EC 1.1.1.- (genes adh1, bdhA and bdhB), enzymes that have activity using butanol and ethanol as substrates. E. coli adhE, an iron-dependent enzyme that harbours three different activities: alcohol dehydrogenase, acetaldehyde dehydrogenase (acetylating) EC 1.2.1.10 and pyruvate-formate-lyase deactivase. Bacterial glycerol dehydrogenase EC 1.1.1.6 (gene gldA or dhaD). Clostridium kluyveri NAD-dependent 4-hydroxybutyrate dehydrogenase (4hbd) EC 1.1.1.61 Citrobacter freundii and Klebsiella pneumoniae 1,3-propanediol dehydrogenase EC 1.1.1.202 (gene dhaT) Bacillus methanolicus NAD-dependent methanol dehydrogenase EC 1.1.1.244 E. coli and Salmonella typhimurium ethanolamine utilization protein eutG. E. coli hypothetical protein yiaY.
Sources: en.wikipedia.org
No, it is a synthetic peptide fragment corresponding to a small portion of hGH. It is not the full 191-amino-acid hormone and does not reproduce all of hGH's effects.
It is commonly described as a 16-amino-acid peptide based on residues 176-191 of human growth hormone. Some sources vary in notation, so checking the stated sequence is useful.
It is not typically described as a standalone natural hormone. The sequence is derived from the C-terminal region of human growth hormone, but the synthetic peptide is a laboratory-made construct.
No major medicines regulator appears to have approved AOD-9604 for human therapeutic use. It has been studied in clinical trials, but those programs did not result in a marketed drug.