mass spectrometry comes up often in conversation and rarely with the context attached. Here we lay out the basics in order, then work through the practical considerations.
Last reviewed on 2025-10-19. Where a claim depends on a specific study, the study is described rather than over-claimed.
AOD-9604 is a synthetic peptide that corresponds to a short section of human growth hormone. It is commonly identified as hGH fragment 176-191 because its sequence matches residues at the C-terminal end of the hormone. The molecule contains sixteen amino acids and is made by solid-phase peptide synthesis. Researchers study it for metabolic effects rather than for the growth-promoting actions associated with full human growth hormone. Its small size distinguishes it from the complete 191-amino-acid hormone.
Several names appear in scientific and commercial settings. AOD9604 and AOD-9604 are development codes used interchangeably, while hGH fragment 176-191 describes the same region. The peptide includes a disulfide bond between two cysteine residues, which helps shape its three-dimensional structure. Different suppliers may provide acetate or other salt forms, and purity can vary. These differences matter because analytical tests and biological assays can respond to the specific form being studied.
Stability of AOD-9604 depends on storage conditions. Lyophilized powder is generally more stable than reconstituted solution. Recommended storage is typically at -20°C or lower, protected from light and moisture. Repeated freeze-thaw cycles can cause aggregation or degradation. In solution, the peptide may be susceptible to hydrolysis or oxidation, so aliquoting and cold storage are common practices. Researchers often add stabilizers such as mannitol or trehalose during lyophilization to improve shelf life.
Quality control for AOD-9604 involves verifying identity, purity, and concentration. Suppliers may provide a certificate of analysis listing HPLC purity and mass spectrometry data. Independent verification is advised because peptide products can vary in quality. Researchers should check for counterions, residual solvents, and microbial contamination. Proper documentation supports reproducibility and safety in laboratory studies. When sourcing, institutions often require third-party testing and detailed chain-of-custody records. These steps help ensure that experimental results are attributable to the peptide rather than impurities.
Analytical characterization of AOD-9604 typically employs reversed-phase high-performance liquid chromatography (RP-HPLC) to assess purity and identity. Mass spectrometry provides confirmation of molecular mass, while amino acid analysis can verify composition. These methods are standard for peptide research chemicals. Because the peptide lacks a distinct chromophore, detection often relies on ultraviolet absorbance at 214 nm or mass spectrometric response. Laboratories may also use capillary electrophoresis for separation. For example, size-exclusion chromatography can detect aggregates.
| Property | Value | Notes |
|---|---|---|
| Common name | AOD-9604 | Development code used in scientific literature. |
| Chemical class | Synthetic peptide | Fragment of human growth hormone. |
| Amino acid length | 16 residues | Matches hGH region 176-191. |
| Appearance | White to off-white powder | Typical lyophilized peptide solid. |
| Solubility | Soluble in water | Dissolves in aqueous media; exact behavior depends on salt form. |
AOD-9604 is a synthetic peptide modeled on the C-terminal region of human growth hormone. It is often described as hGH fragment 176-191. Research interest arose because it was designed to isolate possible effects on fat metabolism from other actions of growth hormone. It is not a full growth hormone molecule. Its development history includes early laboratory and animal studies followed by human trials. The peptide has been examined in laboratory, animal, and limited human studies.
The compound has been studied as a potential treatment for obesity and related metabolic conditions. Published trials have examined changes in body weight, fat mass, and safety markers over limited durations. Results have been mixed or modest, and no large-scale outcome trials are established. Regulatory agencies in several countries have not approved it as a therapeutic drug. Some commercial products have been marketed outside regulated pharmaceutical channels, which raises questions about quality and claims.
In the scientific literature, AOD-9604 appears in reviews of growth hormone fragments and in discussions of peptide-based metabolic research. Some sources distinguish it from growth hormone itself, while others group it with compounds marketed for weight management. The evidence base is small compared with approved obesity medications. Questions about long-term efficacy and clinical relevance remain open, and independent replication of key findings is limited. Most published reports are early-stage and exploratory.
Clinical development of AOD-9604 included trials in people with obesity. Reports from early-phase and mid-phase studies described modest or inconsistent changes in body weight. A phase IIb program did not meet its primary endpoint, and the compound was not approved for medical use. Differences in formulation, delivery route, and participant characteristics may explain some of the variation. Later investigations explored whether the peptide might have effects in other tissues, including cartilage.
Regulatory treatment of AOD-9604 is shaped by its classification as a peptide hormone. The World Anti-Doping Agency lists it as a prohibited substance, and many national anti-doping organizations adopt that list. It does not hold approval as a prescription medicine in the United States, the European Union, or other major markets. Products sold online are frequently labeled for research use only and may not undergo independent quality testing. Import and possession rules differ by country, so legal status depends on local law.
Proposed mechanisms for AOD-9604 focus on fat cells. Laboratory studies suggest the peptide can increase lipolysis, the breakdown of stored fat, and reduce lipogenesis, the formation of new fat. Unlike full human growth hormone, it does not appear to stimulate substantial IGF-1 production in the studies reported so far. Some evidence points to beta-adrenergic signaling, but the precise receptor targets and downstream pathways remain unresolved. The fragment is not thought to act through the classical growth hormone receptor.
In laboratory settings, AOD-9604 is commonly supplied as a lyophilized powder and stored cold to limit degradation. Reconstituted solutions are typically kept refrigerated or frozen, depending on the buffer and concentration, and protected from repeated freeze-thaw cycles. Stability can be influenced by pH, temperature, and the presence of proteases. Purity is usually assessed by high-performance liquid chromatography and mass spectrometry. These practices support reproducibility, but they do not imply safety or efficacy for any human use.
Regulatory status: AOD-9604 is not approved as a therapeutic drug in the United States, European Union, or other major markets. It is listed by the World Anti-Doping Agency as a prohibited substance in sport, specifically under growth hormone fragments. Many jurisdictions restrict its sale for human consumption. Products marketed online may not meet pharmaceutical quality standards. The legal status varies by country and often depends on whether the material is presented as a research chemical, supplement, or drug.
Detection and characterization of AOD-9604 in research and anti-doping settings typically rely on mass spectrometry coupled with liquid chromatography. These methods can identify the peptide by its mass and fragmentation pattern. Immunoassays may also be used in some screening contexts, but they can cross-react with related peptides. Because the molecule is small and may be present at low concentrations, sample preparation and method validation are important. Confirmatory analysis usually requires comparison with a certified reference standard.
Research has examined whether the peptide affects fat mass independently of growth hormone's other actions. Early animal studies suggested reductions in body fat, but species differences and small sample sizes limit interpretation. Human studies have generally been short and have not consistently shown large effects. Some trials measured body composition, lipid profiles, and safety parameters, but the overall picture is one of suggestive yet inconclusive metabolic activity. Findings vary across study populations and protocols.
A central uncertainty is whether observed metabolic changes translate into meaningful clinical benefits. Study designs vary in dose, duration, and participant characteristics, making comparisons difficult. Independent replication is limited, and the field lacks consensus on optimal endpoints or treatment duration. Ongoing or future studies may clarify mechanism and effect size, but current evidence does not establish a clear therapeutic role. Researchers often call for larger, longer, and better-controlled trials, while questions remain about which patient groups might respond.
== Limitations == SELDI is often criticized for its reproducibility due to differences in the mass spectra obtained when using different batches of chip surfaces. While the method has been successful with analyzing low molecular weight proteins, consistent results have not been obtained when analyzing high molecular weight proteins. There also exists a potential for sample bias, as nonspecific absorption matrices favor the binding of analytes with higher abundances in the sample at the expense of less abundant analytes. While SELDI-TOF-MS has detection limits in the femtomolar range, the baseline signal in the spectra varies and noise due to the matrix is maximal below 2000 Da, with Ciphergen Biosystems suggesting to ignore spectral peaks below 2000 Da.
Removal of a proton from an aliphatic –OH group is difficult to achieve in aqueous solution because the energy required for this process is rather large. Thus, ionization of aliphatic –OH groups occurs in aqueous solution only in special circumstances. One such circumstance is found with compounds containing the H2N–C–C–OH substructure. For example, compounds containing the 2-aminoethanol substructure can form metal–chelate complexes with the deprotonated form, H2N–C–C–O−. The chelate effect supplies the extra energy needed to break the O–H bond. An important example occurs with the molecule tris. This molecule should be used with caution as a buffering agent as it will form chelate complexes with ions such as Fe3+ and Cu2+.
==== Plasmid delivery ==== Individual genes can be inserted into specific sites on plasmids, and recombinant plasmids can be introduced into living cells. A method using macro-branched TAT has been proposed for plasmid DNA delivery into various cell lines and showed significant transfection capabilities. Multimers of TAT have been found to increase transfection efficiency of plasmid DNA by 6-8 times more than poly-L-arginine or mutant TAT2-M1, and by 390 times compared with the standard vectors.
== Deficiency == Plasma vitamin C is the most widely applied test for vitamin C status. Adequate levels are defined as near 50 μmol/L. Hypovitaminosis of vitamin C is defined as less than 23 μmol/L, and deficiency as less than 11.4 μmol/L. For people 20 years of age or above, data from the US 2017–18 National Health and Nutrition Examination Survey showed mean serum concentrations of 53.4 μmol/L. Deficiency was reported in 5.9% of people. Globally, vitamin C deficiency is common in low and middle-income countries, and not uncommon in high income countries. In the latter, prevalence is higher in males than in females. Plasma levels are considered saturated at about 65 μmol/L, achieved by intakes of 100 to 200 mg/day, which are well above the recommended intakes. Even higher oral intake does not further raise plasma nor tissue concentrations because absorption efficiency decreases and any excess that is absorbed is excreted in urine.
Sources: en.wikipedia.org
=== Legal status === In April 2025, the Committee for Medicinal Products for Human Use (CHMP) of the European Medicines Agency adopted a positive opinion, recommending the granting of a marketing authorization for the medicinal product Tepezza, intended for the treatment of adults with moderate to severe thyroid eye disease. The applicant for this medicinal product is Amgen Europe B.V. Teprotumumab was authorized for medical use in the European Union in June 2025. The CHMP's opinion is based on data from three randomized, placebo-controlled trials in a total of 225 participants with active thyroid eye disease, and one trial in 62 participants with chronic thyroid eye disease. After 24 weeks, participants treated with teprotumumab experienced a significant reduction (-2 to -2.3 mm) in protrusion of the eyeball from the eye socket (proptosis) and in the clinical activity score, a standard tool to evaluate inflammatory signs and symptoms of thyroid eye disease, compared to participants treated with placebo. The reduction in proptosis was smaller (-1.5mm) in participants with chronic thyroid eye disease.
Simón Bolívar, who during his dictatorship in Peru would have wanted to perpetuate himself in power against the Peruvian will through the Lifetime Constitution, in turn carried out repression against several Peruvian politicians to favor his personal project of the Federation of the Andes, In addition to being accused of having written a Peruvian-phobic letter to Santander on January 7, 1824 (in Pativilca), where he referred to Peruvians and Quito people as Indians (in a derogatory way) and inferior to the Venezuelans."I think I have told you, before now, that the Quitos are the worst Colombians. The fact is that I have always thought so. The Venezuelans are saints compared to those evil ones. The Quitos and the Peruvians are the same thing: vicious to the point of infamy and base to the extreme. The whites have the character of the Indians, and the Indians are all truchimanes, all thieves, all liars, all false, without any moral principle to guide them.
==== Blue ==== Prussian blue, or blue, a coloring used in the treatment of radiation, cesium, and thallium poisoning, can turn the feces blue. Substantial consumption of products containing blue food dye, such as blue curaçao or grape soda, can have the same effect.
Sources: en.wikipedia.org
== Chemistry == Bulevirtide is a 47-amino acid long lipopeptide with the following sequence: CH3(CH2)12CO-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro-Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp-Trp-Asp-Phe-Asn-Pro-Asn-Lys-Asp-His-Trp-Pro-Glu-Ala-Asn-Lys-Val-Gly-NH2 (C13H27CO-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH2)
===== Mood ===== We can describe mood not as specific to an emotional status, but as associated with a relatively long-lasting emotional state. Serotonin's association with mood is most known for various forms of depression and bipolar disorders in humans. Disorders caused by serotonergic activity potentially contribute to the many symptoms of major depression, such as overall mood, activity, suicidal thoughts and sexual and cognitive dysfunction. Selective serotonin reuptake inhibitors (SSRI's) are a class of drugs demonstrated to be an effective treatment in major depressive disorder and are the most prescribed class of antidepressants. SSRI's function is to block the reuptake of serotonin, making more serotonin available to absorb by the receiving neuron. Animals have been studied for decades in order to understand depressive behavior among species. One of the most familiar studies, the forced swimming test (FST), was performed to measure potential antidepressant activity. Rats were placed in an inescapable container of water, at which point time spent immobile and number of active behaviors (such as splashing or climbing) were compared before and after a panel of anti-depressant drugs were administered. Antidepressants that selectively inhibit NE reuptake were shown to reduce immobility and selectively increase climbing without affecting swimming. However, results of the SSRI's also show reduced immobility but increased swimming without affecting climbing.
Endothelial progenitor cell (or EPC) is a term that has been applied to multiple different cell types that play roles in the regeneration of the endothelial lining of blood vessels. Outgrowth endothelial cells are an EPC subtype committed to endothelial cell formation. Despite the history and controversy, the EPC in all its forms remains a promising target of regenerative medicine research.
=== Improving agricultural productivity === Iran's agricultural sector has faced declining productivity due to water shortages, outdated irrigation systems, and inefficient farming practices. Improving agricultural productivity is key to stabilizing food prices, and several steps can be taken. Modernizing Irrigation Techniques: Iran relies heavily on water-intensive crops like rice and wheat. The country also has one of the highest water withdrawal rates in the world. Transitioning to modern irrigation systems such as drip or precision farming can reduce water usage while increasing crop yields. Adopting New Agricultural Technologies: Investing in agricultural technology, including mechanization, better seeds (e.g., drought-resistant varieties), and soil fertility management, could significantly boost production efficiency. Government Support for Farmers: Providing education, subsidies, and financial assistance to small farmers can help them transition to more sustainable practices. Support programs targeting efficient use of resources would increase resilience against price shocks and reduce reliance on imports.
Sources: en.wikipedia.org
AOD-9604 is a synthetic peptide fragment of human growth hormone. It corresponds to the C-terminal region known as hGH 176-191 and is studied for metabolic effects. It is not an approved therapeutic drug.
No. It contains only a small portion of the human growth hormone sequence. The full hormone has 191 amino acids and many additional actions that the fragment does not share.
The name refers to the amino acid positions in the human growth hormone chain. The fragment spans residues 176 through 191 at the C-terminal end. This naming convention helps distinguish it from full-length hGH.
Reversed-phase HPLC is used to assess purity, and mass spectrometry confirms molecular mass. Amino acid analysis can verify composition. These methods are standard for peptide characterization.